| Read Date | 2005-08-12 07:49:00 |
|---|---|
| Read Number | X0000055511103200508120749 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | clear |
| Cocktail | 5_C0360 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Sodium molybdate dihydrate | 10.0 | 0.1 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
| PEG 20000 | 10.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | PfR75 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 103 aa |
| Mass | 12.37 kD |
| ext | 17420 |
| pI | 4.75 |
| Name | Hypothetical protein PF0246 |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2K4N (NMR) |
| Gene | |
|---|---|
| Organism | Pyrococcus furiosus |
| Genus | Pyrococcus |
| Species | furiosus |
| Strain | |
| Sequence | MNSEVIKEFLEDIGEDYIELENEIHLKPEVFYEVWKYVGEPELKTYVIEDEIVEPGEYDPPEMKYTNVKKVKIKKVYFETLDNVRVVTDYSEFQKILKKRGTK |