| Read Date | 2007-01-19 10:38:00 |
|---|---|
| Read Number | X0000082201445200701191038 |
| Week | <nil> |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 7_C0182 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 |
| Sodium phosphate monobasic | 7.0 | 3.3 M | [Na+].[O-]P(=O)(O)O |
![]() | HR3000 |
|---|---|
| Spine Status | good HSQC collected |
| Length | 225 aa |
| Mass | 25.00 kD |
| ext | 27960 |
| pI | 6.08 |
| Name | RecName: Full=Ras-related protein Rab-32; |
| Database References | NCBI UniProt |
| PFAM | PF00071 |
| PDB Structures | 4CYM (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | AGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC |