 
    | Read Date | 2007-05-22 08:16:00 | 
|---|---|
| Read Number | X0000088401132200705220816 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | crystal | 
| 10-Way Classifier | clear | 
| Cocktail | 7_C1507 | 
| Screen | HWI Generation 7 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium acetate trihydrate | 4.6 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O | 
| Lithium sulfate monohydrate | 4.6 | 0.8 M | [Li+].[Li+].[O-]S([O-])(=… | 
|  | CgR33 | 
|---|---|
| Spine Status | aggregation screening | 
| Length | 264 aa | 
| Mass | 28.04 kD | 
| ext | 5500 | 
| pI | 4.95 | 
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulator of sugar metabolism, DeoR family) | 
| Database References | NCBI UniProt | 
| PFAM | PF00455 | 
| PDB Structures | 
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum | 
| Genus | Corynebacterium | 
| Species | glutamicum | 
| Strain | |
| Sequence | MVSQTERQHAIASLLAPTGAVSVGDLAEHFHVTTETVRRDLRIMESLGLLQRVHGGAISPEPMGTSPPRLKPALGKGMPPEPRVLELAETAVSLITPLARSIFLDSGLACTAIATVLGDPPEDARWTVVTSSPGAVIALSATDATSTVVLHGQVHGNCSSIIGSTAVDMISQLRADIAFVEVDAIQSDTSLCTFFPETIPIKQAMIKNAAFTVAVLSPRSPQDQELQLLKHPFSTLADFDALVTDDHTLDFPVLPDHNFQVVTP |