| Read Date | 2007-05-22 08:25:00 |
|---|---|
| Read Number | X0000088400413200705220825 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C0032 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| MES hydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
| Ammonium phosphate dibasic | 6.0 | 2.1 M | [O-]P([O-])(=O)O.[NH4+].[… |
![]() | CgR33 |
|---|---|
| Spine Status | aggregation screening |
| Length | 264 aa |
| Mass | 28.04 kD |
| ext | 5500 |
| pI | 4.95 |
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulator of sugar metabolism, DeoR family) |
| Database References | NCBI UniProt |
| PFAM | PF00455 |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | MVSQTERQHAIASLLAPTGAVSVGDLAEHFHVTTETVRRDLRIMESLGLLQRVHGGAISPEPMGTSPPRLKPALGKGMPPEPRVLELAETAVSLITPLARSIFLDSGLACTAIATVLGDPPEDARWTVVTSSPGAVIALSATDATSTVVLHGQVHGNCSSIIGSTAVDMISQLRADIAFVEVDAIQSDTSLCTFFPETIPIKQAMIKNAAFTVAVLSPRSPQDQELQLLKHPFSTLADFDALVTDDHTLDFPVLPDHNFQVVTP |