| Read Date | 2007-05-22 11:15:00 |
|---|---|
| Read Number | X0000088401106200705221115 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip |
| Cocktail | 7_C1309 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 4.6 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Ammonium sulfate | 4.6 | 0.2 M | O=S(=O)(O)O.N.N |
| PEG MME 2000 | 4.6 | 30.0 % (w/v) | COCCOCOCCOCOCCOCOCCOCOCCO… |
![]() | CgR33 |
|---|---|
| Spine Status | aggregation screening |
| Length | 264 aa |
| Mass | 28.04 kD |
| ext | 5500 |
| pI | 4.95 |
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulator of sugar metabolism, DeoR family) |
| Database References | NCBI UniProt |
| PFAM | PF00455 |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | MVSQTERQHAIASLLAPTGAVSVGDLAEHFHVTTETVRRDLRIMESLGLLQRVHGGAISPEPMGTSPPRLKPALGKGMPPEPRVLELAETAVSLITPLARSIFLDSGLACTAIATVLGDPPEDARWTVVTSSPGAVIALSATDATSTVVLHGQVHGNCSSIIGSTAVDMISQLRADIAFVEVDAIQSDTSLCTFFPETIPIKQAMIKNAAFTVAVLSPRSPQDQELQLLKHPFSTLADFDALVTDDHTLDFPVLPDHNFQVVTP |