Read Date | 2007-05-22 11:15:00 |
---|---|
Read Number | X0000088401188200705221115 |
Week | 1 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | phase |
Cocktail | 7_C1041 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
Sodium phosphate monobasic monohydrate | 6.3 | 0.6 M | [Na+].[O-]P(=O)(O)O.O |
Potassium phosphate dibasic anhydrous | 6.3 | 0.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | CgR33 |
---|---|
Spine Status | aggregation screening |
Length | 264 aa |
Mass | 28.04 kD |
ext | 5500 |
pI | 4.95 |
Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulator of sugar metabolism, DeoR family) |
Database References | NCBI UniProt |
PFAM | PF00455 |
PDB Structures |
Gene | |
---|---|
Organism | Corynebacterium glutamicum |
Genus | Corynebacterium |
Species | glutamicum |
Strain | |
Sequence | MVSQTERQHAIASLLAPTGAVSVGDLAEHFHVTTETVRRDLRIMESLGLLQRVHGGAISPEPMGTSPPRLKPALGKGMPPEPRVLELAETAVSLITPLARSIFLDSGLACTAIATVLGDPPEDARWTVVTSSPGAVIALSATDATSTVVLHGQVHGNCSSIIGSTAVDMISQLRADIAFVEVDAIQSDTSLCTFFPETIPIKQAMIKNAAFTVAVLSPRSPQDQELQLLKHPFSTLADFDALVTDDHTLDFPVLPDHNFQVVTP |