| Read Date | 2007-06-12 12:22:00 |
|---|---|
| Read Number | X0000088401496200706121222 |
| Week | 4 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip_skin |
| Cocktail | 7_C1526 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 1.2 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | CgR33 |
|---|---|
| Spine Status | aggregation screening |
| Length | 264 aa |
| Mass | 28.04 kD |
| ext | 5500 |
| pI | 4.95 |
| Name | Transcriptional regulators of sugar metabolism (Transcriptionalregulator of sugar metabolism, DeoR family) |
| Database References | NCBI UniProt |
| PFAM | PF00455 |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | MVSQTERQHAIASLLAPTGAVSVGDLAEHFHVTTETVRRDLRIMESLGLLQRVHGGAISPEPMGTSPPRLKPALGKGMPPEPRVLELAETAVSLITPLARSIFLDSGLACTAIATVLGDPPEDARWTVVTSSPGAVIALSATDATSTVVLHGQVHGNCSSIIGSTAVDMISQLRADIAFVEVDAIQSDTSLCTFFPETIPIKQAMIKNAAFTVAVLSPRSPQDQELQLLKHPFSTLADFDALVTDDHTLDFPVLPDHNFQVVTP |