| Read Date | 2007-07-05 15:21:00 |
|---|---|
| Read Number | X0000089661459200707051521 |
| Week | 3 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | precip_skin |
| Cocktail | 7_C0377 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Cobalt (II) sulfate heptahydrate | 5.0 | 0.1 M | [Co+2].[O-]S([O-])(=O)=O.… |
| PEG 20000 | 5.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SyR11 |
|---|---|
| Spine Status | NMR structure |
| Length | 155 aa |
| Mass | 15.92 kD |
| ext | 29910 |
| pI | 4.47 |
| Name | Putative secretory antigen |
| Database References | NCBI UniProt |
| PFAM | PF05257 |
| PDB Structures | 2K3A (NMR) |
| Gene | |
|---|---|
| Organism | Staphylococcus saprophyticus |
| Genus | Staphylococcus |
| Species | saprophyticus |
| Strain | |
| Sequence | MKKLVTATTLTAGIGAAIVGLDHGNEADAAEQTQPTNQSTTQSTSGSSANLYTAGQCTWYVYDKVGGNIGSTWGNANNWASAASSAGYTVNNSPEAGSILQSTAGGYGHVAYVENVNSDGSVEVSEMNYNGGPFSVSERTISAGEASSYNYIHLN |