| Read Date | 2007-06-29 10:50:00 |
|---|---|
| Read Number | X0000089911492200706291050 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 7_C1525 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 0.6 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | BcR103A |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 109 aa |
| Mass | 12.83 kD |
| ext | 10430 |
| pI | 8.67 |
| Name | UPF0090 protein BC_3815 |
| Database References | NCBI UniProt |
| PFAM | PF06486 |
| PDB Structures | 2K5W (NMR) |
| Gene | |
|---|---|
| Organism | Bacillus cereus |
| Genus | Bacillus |
| Species | cereus |
| Strain | |
| Sequence | MERASLNRIGKDVYYMQIKGEGTIEKVDGRNLRNYTLPAYDEDGVKKQITFRSTKKENDHKLNKYAFLRLYVDQDDNSKNEISSIEVKSYEEIQKADLPEKVKDKFTIK |