| Read Date | 2007-07-20 10:26:00 |
|---|---|
| Read Number | X0000090751138200707201026 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 7_C1317 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium phosphate monobasic | 6.5 | 0.1 M | [K+].[O-]P(=O)(O)O |
| Sodium chloride | 6.5 | 2.0 M | [Na+].[Cl-] |
| Sodium phosphate monobasic monohydrate | 6.5 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| MES monohydrate | 6.5 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | SoR78A |
|---|---|
| Spine Status | X-Ray structure |
| Length | 53 aa |
| Mass | 6.20 kD |
| ext | 5960 |
| pI | 4.85 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF06004 |
| PDB Structures | 2RB6 (Xray) |
| Gene | |
|---|---|
| Organism | Shewanella oneidensis |
| Genus | Shewanella |
| Species | oneidensis |
| Strain | |
| Sequence | MSSQYIMSTKDGKMITSDSKPKLDKTTGMYLYYDEDGREVMIKQEDVTQIIER |