Read Date | 2007-09-14 09:59:00 |
---|---|
Read Number | X0000092251232200709140959 |
Week | 0 |
Verified Crystal | |
3-Way Classifier | crystal |
10-Way Classifier | clear |
Cocktail | 7_C1424 |
Screen | HWI Generation 7 |
Name | pH | Concentration | SMILES |
---|---|---|---|
HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
Ammonium acetate | 7.5 | 0.2 M | O=C(O)C.N |
PEG 3350 | 7.5 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | HR3135 |
---|---|
Spine Status | HSQC collected and crystal hits |
Length | 159 aa |
Mass | 17.12 kD |
ext | 12490 |
pI | 4.26 |
Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 gamma;AltName: Full=Cytokine-responsive protein CR6;AltName: Full=DNA-damage-inducible transcript 2; Short=DDIT-2; |
Database References | NCBI UniProt |
PFAM | PF01248 |
PDB Structures | 3FFM (Best Match) |
Gene | |
---|---|
Organism | Homo sapiens |
Genus | Homo |
Species | sapiens |
Strain | |
Sequence | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |