| Read Date | 2007-09-14 10:00:00 | 
|---|---|
| Read Number | X0000092251122200709141000 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | other | 
| 10-Way Classifier | precip | 
| Cocktail | 7_C1313 | 
| Screen | HWI Generation 7 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 5.6 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… | 
| tert-Butanol | 5.6 | 35.0 % (v/v) | CC(C)(C)O | 
![]()  | HR3135 | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 159 aa | 
| Mass | 17.12 kD | 
| ext | 12490 | 
| pI | 4.26 | 
| Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 gamma;AltName: Full=Cytokine-responsive protein CR6;AltName: Full=DNA-damage-inducible transcript 2; Short=DDIT-2;  | 
| Database References | NCBI UniProt | 
| PFAM | PF01248 | 
| PDB Structures | 3FFM (Best Match) | 
| Gene | |
|---|---|
| Organism | Homo sapiens | 
| Genus | Homo | 
| Species | sapiens | 
| Strain | |
| Sequence | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |