| Read Date | 2007-09-28 11:40:00 |
|---|---|
| Read Number | X0000092251022200709281140 |
| Week | 3 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 7_C1216 |
| Screen | HWI Generation 7 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES | 7.0 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… |
| Ammonium sulfate | 7.0 | 2.4 M | O=S(=O)(O)O.N.N |
![]() | HR3135 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 159 aa |
| Mass | 17.12 kD |
| ext | 12490 |
| pI | 4.26 |
| Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 gamma;AltName: Full=Cytokine-responsive protein CR6;AltName: Full=DNA-damage-inducible transcript 2; Short=DDIT-2; |
| Database References | NCBI UniProt |
| PFAM | PF01248 |
| PDB Structures | 3FFM (Best Match) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE |