 
    | Read Date | 2007-10-15 09:51:00 | 
|---|---|
| Read Number | X0000093581160200710150951 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | crystal | 
| 10-Way Classifier | crystal | 
| Cocktail | 7_C1034 | 
| Screen | HWI Generation 7 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.6 | 0.7 M | [Na+].[O-]P(=O)(O)O.O | 
| Potassium phosphate dibasic anhydrous | 5.6 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… | 
|  | HR3159 | 
|---|---|
| Spine Status | HSQC collected and crystal hits | 
| Length | 160 aa | 
| Mass | 17.82 kD | 
| ext | 15470 | 
| pI | 4.33 | 
| Name | RecName: Full=Growth arrest and DNA-damage-inducible protein GADD45 beta;AltName: Full=Myeloid differentiation primary response protein MyD118;AltName: Full=Negative growth regulatory protein MyD118; | 
| Database References | NCBI UniProt | 
| PFAM | PF01248 | 
| PDB Structures | 2KG4 (Best Match) | 
| Gene | |
|---|---|
| Organism | Homo sapiens | 
| Genus | Homo | 
| Species | sapiens | 
| Strain | |
| Sequence | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |